PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10025063m
Common NameCARUB_v10025063mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 201aa    MW: 23152.5 Da    PI: 6.0298
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10025063mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.62.5e-28107165159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYG+K+++g+++pr+Y++C+ ++C+vkkk+er+++dp++v +tYeg Hnh+
  Carubv10025063m 107 LDDGYKWRKYGKKPITGTPYPRHYHKCSDPDCKVKKKIERDTSDPDYVWTTYEGIHNHP 165
                      59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-27100167IPR003657WRKY domain
PROSITE profilePS5081128.392102167IPR003657WRKY domain
SuperFamilySSF1182901.96E-24104167IPR003657WRKY domain
SMARTSM007745.2E-29107166IPR003657WRKY domain
PfamPF031062.5E-20108165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MNYPSNPNPN YTDFTEFFKF DDFADSFDMI MEEIGREDHS SSPTLSWTSS EKIVAAEITS  60
PFQTSLATSP MSLEIGDKSH EIKKRKRHKE DPIIQAFRTK SPEKDALDDG YKWRKYGKKP  120
ITGTPYPRHY HKCSDPDCKV KKKIERDTSD PDYVWTTYEG IHNHPSPSVV YCESDDFDLT  180
SHNNWCFQTN TYGFSHSAPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-231031681378Probable WRKY transcription factor 4
2lex_A2e-231031681378Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00270DAPTransfer from AT2G21900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295926.11e-149hypothetical protein CARUB_v10025063mg
SwissprotQ9SJ098e-98WRK59_ARATH; Probable WRKY transcription factor 59
TrEMBLR0HGK71e-149R0HGK7_9BRAS; Uncharacterized protein
STRINGBra030273.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138351726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21900.11e-98WRKY DNA-binding protein 59